PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g069960.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 311aa    MW: 35723.9 Da    PI: 6.2694
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g069960.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.52.8e-49311572128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratk.sgyWkatgkdk 90 
                          pGfrFhPtdeelv +yL++k+e+k + l e+ik++diyk++PwdLpk + +++ekewyfF+kr +ky+++ r+nr+t  sg+Wkatg d+
  Solyc02g069960.2.1  31 LPGFRFHPTDEELVGFYLRRKIEKKIIGL-EIIKQIDIYKYDPWDLPKgSNNNGEKEWYFFCKRGRKYKNSLRPNRVTGgSGFWKATGIDR 120
                         69************************999.99***************535666889********************77669********** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++s +g+ +glkk+Lv+y+g+a kg+kt+W mhe+rl
  Solyc02g069960.2.1 121 PIYS-SGKCIGLKKSLVYYRGSAGKGTKTEWQMHEFRL 157
                         ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.72530188IPR003441NAC domain
SuperFamilySSF1019413.4E-5230188IPR003441NAC domain
PfamPF023651.4E-2432157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEVEKISSIV TNNYYEDEDE DEDDDDDDVV LPGFRFHPTD EELVGFYLRR KIEKKIIGLE  60
IIKQIDIYKY DPWDLPKGSN NNGEKEWYFF CKRGRKYKNS LRPNRVTGGS GFWKATGIDR  120
PIYSSGKCIG LKKSLVYYRG SAGKGTKTEW QMHEFRLPVE NDKSTKHLHA NTIPQQDETW  180
TLCRILKRNV SYKKPIPDWK EVAKKQRNNS VMNMDVLSSK ICSNSSIESS PNSSQIFISF  240
STTSVVKQNT YTNTITENKH QFVSQQSSGT SSQSTTVGAA STPLDFNEWL EHGNWDELES  300
IFELSFDPLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-473219419171NO APICAL MERISTEM PROTEIN
1ut4_B3e-473219419171NO APICAL MERISTEM PROTEIN
1ut7_A3e-473219419171NO APICAL MERISTEM PROTEIN
1ut7_B3e-473219419171NO APICAL MERISTEM PROTEIN
3swm_A3e-473219422174NAC domain-containing protein 19
3swm_B3e-473219422174NAC domain-containing protein 19
3swm_C3e-473219422174NAC domain-containing protein 19
3swm_D3e-473219422174NAC domain-containing protein 19
3swp_A3e-473219422174NAC domain-containing protein 19
3swp_B3e-473219422174NAC domain-containing protein 19
3swp_C3e-473219422174NAC domain-containing protein 19
3swp_D3e-473219422174NAC domain-containing protein 19
4dul_A3e-473219419171NAC domain-containing protein 19
4dul_B3e-473219419171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153620.0Solanum lycopersicum chromosome 2 clone C02HBa0027B01, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233159.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK552e-80NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLK4B7X80.0K4B7X8_SOLLC; Uncharacterized protein
STRINGSolyc02g069960.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12910.16e-68NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]